PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009602702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 299aa    MW: 34495.1 Da    PI: 9.302
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009602702.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.39.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed+ll +++k+ G g+W++ ++  g+ R++k+c++rw +yl
   XP_009602702.1 14 KGPWSSKEDLLLTNYIKENGEGQWRSLPKNAGLLRCGKSCRLRWMNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding53.74.6e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++l+++++ +lG++ W++Ia +++ gRt++++k++w+++l
   XP_009602702.1  67 RGNFSQDEEDLILRLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-21564IPR009057Homeodomain-like
PROSITE profilePS5129415.11961IPR017930Myb domain
SuperFamilySSF466893.63E-2811108IPR009057Homeodomain-like
SMARTSM007174.6E-111363IPR001005SANT/Myb domain
PfamPF002494.1E-131461IPR001005SANT/Myb domain
CDDcd001671.64E-71661No hitNo description
PROSITE profilePS5129425.87962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2565117IPR009057Homeodomain-like
SMARTSM007174.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.0E-1567112IPR001005SANT/Myb domain
CDDcd001679.30E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRKPCCAKE GLRKGPWSSK EDLLLTNYIK ENGEGQWRSL PKNAGLLRCG KSCRLRWMNY  60
LRPGIKRGNF SQDEEDLILR LHSLLGNRWS LIAGRLPGRT DNEIKNYWNT HLIKKLKSAG  120
IEPKPHKKFS KCSKKESRKG PQQEKSRKKQ GKKSNNKNNE GQIVQVEKIQ VFTPKPIRIS  180
SEVLSRNNSF ENVTLSTNCS SNSNFEEADA DNKETELKLE EVSFFPRDLD FGKLLEGDAN  240
LDEFLIQESS YISNKYSVPM NESMLEKVYE EYLLLLSENC YLQDDHQKEQ NFPVNVSNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-25121185110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009602702.10.0PREDICTED: transcription factor MYB3-like
TrEMBLA0A0V0HKF81e-143A0A0V0HKF8_SOLCH; Putative transcription factor MYB3-like
STRINGPGSC0003DMT4000316071e-142(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.14e-65myb domain protein 5